PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G373400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 275aa    MW: 30947.7 Da    PI: 6.1116
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G373400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg+WT+eEd llv ++++ G g+W++ ++  g+ R++k+c++rw +yl
  Aqcoe2G373400.1.p 14 RGPWTPEEDHLLVSYIQENGHGNWRALPKLAGLLRCGKSCRLRWTNYL 61
                       89******************************99************97 PP

2Myb_DNA-binding54.42.8e-1767112148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg++T eE+e + +++++lG++ W++Ia++++ gRt++++k+ w+++l
  Aqcoe2G373400.1.p  67 RGNFTDEEEETIMQLHEKLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                        89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.799961IPR017930Myb domain
SuperFamilySSF466898.8E-3110108IPR009057Homeodomain-like
SMARTSM007171.2E-121363IPR001005SANT/Myb domain
PfamPF002492.1E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-241568IPR009057Homeodomain-like
CDDcd001674.41E-91661No hitNo description
PROSITE profilePS5129426.40162116IPR017930Myb domain
SMARTSM007179.7E-1566114IPR001005SANT/Myb domain
PfamPF002495.4E-1667112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2769117IPR009057Homeodomain-like
CDDcd001672.69E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MGRAPCCEKM GLKRGPWTPE EDHLLVSYIQ ENGHGNWRAL PKLAGLLRCG KSCRLRWTNY  60
LRPDIKRGNF TDEEEETIMQ LHEKLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLKHSQ  120
VTPDTKSHLI KSEANMGKES KSKSKANSRK FSAPKINDEI PAPMSPQPSS SELSSGIVST  180
TTTGESTTIT GENDKNSSKD EYTESWETLP QTDESLWSGV MPMEHFSLME ELSTMSTDPA  240
LQFPVSSSLS TQSSIIDDEF WYDLFAKAEE LPEF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-27121162105MYB PROTO-ONCOGENE PROTEIN
1h8a_C3e-271211625128MYB TRANSFORMING PROTEIN
1mse_C2e-27121162105C-Myb DNA-Binding Domain
1msf_C2e-27121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262320.13e-99PREDICTED: myb-related protein Myb4
TrEMBLQ029932e-98Q02993_PETHY; Protein 2
STRINGPOPTR_0005s24550.13e-93(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.19e-75myb domain protein 14